PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g032250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 232aa    MW: 26726 Da    PI: 8.792
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g032250.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.51.7e-2186145357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  Sopen04g032250.1  86 TRWNPTQEQIGILEMLYRGgMRTPNAQQIEQITAQLgkygKIEGKNVFYWFQNHKARERQ 145
                       7*****************99**************************************97 PP

2Wus_type_Homeobox118.43.2e-3886147465
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        tRW+Pt+eQi iLe+ly+ G+rtPn+++i++ita+L +yGkie+kNVfyWFQN+kaRerqkq
   Sopen04g032250.1  86 TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQ 147
                        8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.55E-1381151IPR009057Homeodomain-like
PROSITE profilePS5007110.28481146IPR001356Homeobox domain
SMARTSM003891.2E-783150IPR001356Homeobox domain
CDDcd000862.42E-586147No hitNo description
PfamPF000463.3E-1986145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.0E-887145IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MKVHQFTRGF LEHEAASPSL TLGCKRLRPL APKLNTTNND TTTTIVTPPF DLKSFIRPES  60
SNSPPKLAYN EDKKDSSQVE SHPGGTRWNP TQEQIGILEM LYRGGMRTPN AQQIEQITAQ  120
LGKYGKIEGK NVFYWFQNHK ARERQKQKRN SLGLSQSPRT PSAIVTSPLS FDTRGEVVRD  180
EDSPYKRKCR GWTFEYMEEE QQQQQDEEEI INCRENGDRT LQLFPLHPEG MR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4408490.0FJ440849.1 Solanum lycopersicum WOX4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015072151.11e-175PREDICTED: WUSCHEL-related homeobox 4
SwissprotQ6X7J92e-76WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLM1ADW41e-172M1ADW4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000206621e-172(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61862335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.12e-74WUSCHEL related homeobox 4